- HRSP12 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-82452
- Unconjugated
- 0.1 ml
- Rabbit
- Human, Mouse, Rat
- This antibody was developed against Recombinant Protein corresponding to amino acids: GCDFTNVVKT TVLLADINDF NTVNEIYKQY FKSNFPARAA YQVAALPKGS RIEIEAVAIQ GP
- HRSP12, P14.5, PSP, UK114, hp14.5
- HRSP12
- Western Blot, Immunohistochemistry-Paraffin
- PBS (pH 7.2) and 40% Glycerol
- reactive intermediate imine deaminase A homolog
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Cancer
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
GCDFTNVVKTTVLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSRIEIEAVAIQGP
Specifications/Features
Available conjugates: Unconjugated